Host taxon 10090
Protein NP_001280612.1
ZW10 interactor
Mus musculus
Gene Zwint, UniProt Q9CQU5
>NP_001280612.1|Yersinia pseudotuberculosis IP 32953|ZW10 interactor
MADAEKNAVAEKNNAVATKEVLAEAAAILEPVGLQEEAELPAKIMEEFMRNSRKKDKLLCSQLQVVNFLQTFLAQEDTEQSPDALASEDASRQKATETKEQWKDMKATYMDHVDVIKCALSEALPQVKEAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWVLQQKRLQNLTKISAEVKRRRKRALEKLDGSHQELETLKQQAGQEQEKLQRNQSYLQLLCSLQNKLVISEGKAEDKDVKGRALTAKSKSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.11 | 1.1070085705252 | 8.6e-8 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)