Host taxon 10090
Protein NP_001264168.1
zinc finger matrin-type protein 4 isoform 2
Mus musculus
Gene Zmat4, UniProt Q8BZ94
>NP_001264168.1|Yersinia pseudotuberculosis IP 32953|zinc finger matrin-type protein 4 isoform 2
MVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKPPLKTTAAPLSSLKAPRVDTAPVVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYEGKKHKKNAARVALLEQLGTSLDLGELRGLRRTYRCTTCSVSLNSIEQYHAHLQGSKHQTNLKNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.48 | -2.47867106334073 | 0.041 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)