Bacterial taxon 273123
Protein WP_011192414.1
zinc ABC transporter substrate-binding protein ZnuA
Yersinia pseudotuberculosis IP 32953
Gene znuA, UniProt Q66AT6
>WP_011192414.1|Yersinia pseudotuberculosis IP 32953|zinc ABC transporter substrate-binding protein ZnuA
MLHKNKWLKQAMLASALLLANPFNLASAAVVTSIRPLGFIAAAIADGVLPTEVLLPDGASPHDYALRPSDVQRLRSAELVIWVGPEMEAFLSKPLTQVAENKQIALSQLPSVTPLLMKSDEHDEAEEGESGHHHDHAKDNPTDDHHHGEYNMHIWLSPAIAKQAAIAIHDRLLELTPQNKDKLDANLRRFEDQLAQNEKNIVTMLKPVQGKGYFVFHDAYGYFENHFGLSPLGHFTVNPEIQPGAQRLHQIRTQLVEHKAVCVFAEPQFRPAVINAVAKGTNVRSGTLDPLGSGIVLDKDSYVNFLSQLSNQYVSCLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.7 | 2.70064582973633 | 9.7e-45 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.53 | 2.53189552706127 | 1.7e-62 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.47 | 2.47471615214289 | 4.3e-28 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.92 | 1.92256927287034 | 5.8e-23 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.7 ms
(Link to these results)