Bacterial taxon 273123
Protein WP_002211197.1
zinc ABC transporter permease subunit ZnuB
Yersinia pseudotuberculosis IP 32953
Gene znuB, UniProt Q66AT8
>WP_002211197.1|Yersinia pseudotuberculosis IP 32953|zinc ABC transporter permease subunit ZnuB
MIELLLPGWLAGVLLATAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLNVNPFYAVIAMTMVLALILVWLERRPQLAVDTLLGIMAHSALSLGLVVVSLMSNVRVDLMAYLFGDLLSVTLSDIWLIAAGVVVVLAVLFWQWRALLSMTISPELAHVDGVNLERVRMLLMLVTALTIGLSMKFVGALIITSLLIIPAAAARRFARTPEQMAGIAVGIGILAVTGGLTFSAFYDTPAGPSVVLCAAAMFVLSLSQKARG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.63 | 1.62986897407938 | 0.0022 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.57 | 1.57492236945365 | 6.4e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.48 | 1.47530066569613 | 0.00025 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.25 | 1.24576044373001 | 0.03 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 1.3 ms
(Link to these results)