Host taxon 10090
Protein NP_001132991.1
Z-DNA-binding protein 1 isoform 2
Mus musculus
Gene Zbp1, UniProt Q9QY24
>NP_001132991.1|Yersinia pseudotuberculosis IP 32953|Z-DNA-binding protein 1 isoform 2
MAEAPVDLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIGGAASGDGAPAIPENSSAQPSLDERILRFLEANGPHRALHIAKALGMTTAKEVNPLLYSMRNKHLLSYDGQTWKIYHSRQEGQDIVLPCSPGCPRTHHVDQAGLEPTEIFLLLPIKFWD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.39 | 1.39318911742652 | 9.9e-10 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)