Bacterial taxon 273123
Protein WP_011191548.1
Xaa-Pro dipeptidase
Yersinia pseudotuberculosis IP 32953
Gene pepQ, UniProt Q66FR7
>WP_011191548.1|Yersinia pseudotuberculosis IP 32953|Xaa-Pro dipeptidase
METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLDDRDYPFKVNPQFKAWVPVTEVPNCWLWVDGVNTPKLWFYSPVDYWHSVEPLPDSFWTKNIDVQPLLNADDIAQQLPVQRERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRSYKTDYELACMREAQKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIVALNEHSAVLHYTILQHQPPAEIRSFLIDAGAEYNGYAADLTRTYAADRDSDFAALISDLNTEQLALIDTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLPHGLGHPLGLQVHDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDSLLAPWRIGEFSKHFNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.43 | -1.43012149403315 | 6.9e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.22 | -1.21904917457992 | 1.3e-7 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.21 | -1.20858084103556 | 9.2e-5 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.13 | -1.13163651064618 | 2.8e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 2 ms
(Link to these results)