Host taxon 10090
Protein NP_075884.1
WAP four-disulfide core domain protein 1 precursor
Mus musculus
Gene Wfdc1, UniProt Q9ESH5
>NP_075884.1|Yersinia pseudotuberculosis IP 32953|WAP four-disulfide core domain protein 1 precursor
MGNCGRKVLRALSFLLLLGSSSAQGTWEAMLPARLAEKSRAEEVAATGSRQPHADRCPPPPRTLPPGACQATRCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAETCSTTEDGAEPLLCPSGYECHILQPGDEAQGIPNHGQCVKQRRQAEGRVLRQRLHKEYPEGDSKNVAEPGKGQQRHFP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.31 | -2.31251467503197 | 4.0e-5 | 28096329 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)