Host taxon 10090
Protein NP_849257.1
vimentin-type intermediate filament-associated coiled-coil protein isoform 1
Mus musculus
Gene Vmac, UniProt Q8BP01
>NP_849257.1|Yersinia pseudotuberculosis IP 32953|vimentin-type intermediate filament-associated coiled-coil protein isoform 1
MSAPPPLQIREANAHLAAVHRRAAELERRLLAAERTIGAQAERLACHDQHLRAALDELGRAKDREISALQEQLLSSEATVRSLQAAVDQRDQMIQQLQPRADLLQDITRHRPPLAALLATLEEAEELGPLPASHSHRAQLLPDGPGPPLGNNMGKEEGQDDQDDQQPAVFGTTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.33 | -1.33003760818068 | 7.9e-5 | 28096329 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)