Host taxon 10090
Protein NP_062780.2
vesicle-associated membrane protein-associated protein B
Mus musculus
Gene Vapb, UniProt Q8BH80
>NP_062780.2|Yersinia pseudotuberculosis IP 32953|vesicle-associated membrane protein-associated protein B
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKIIPTSASKTEAPAAAKSLTSPLDDTEVKKVMEECRRLQGEVQRLREESRQLKEEDGLRVRKAMPSNSPVAALAATGKEEGLSARLLALVVLFFIVGVIIGKIAL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.51 | 0.513307485765256 | 0.0035 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)