Host taxon 10090
Protein NP_001334054.1
vesicle-associated membrane protein 4 isoform 2
Mus musculus
Gene Vamp4, UniProt O70480
>NP_001334054.1|Yersinia pseudotuberculosis IP 32953|vesicle-associated membrane protein 4 isoform 2
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALAAAILLLMIIILIVVKFRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.11 | 1.10950932090481 | 0.0011 | 28096329 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)