Host taxon 10090
Protein NP_598525.1
V-type proton ATPase subunit e 2 isoform 1
Mus musculus
Gene Atp6v0e2, UniProt Q91XE7
>NP_598525.1|Yersinia pseudotuberculosis IP 32953|V-type proton ATPase subunit e 2 isoform 1
MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.87 | -0.872586160245002 | 0.015 | 28096329 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)