Host taxon 10090
Protein NP_001153044.1
V-type immunoglobulin domain-containing suppressor of T-cell activation isoform 2 precursor
Mus musculus
Gene Vsir, UniProt Q9D659
>NP_001153044.1|Yersinia pseudotuberculosis IP 32953|V-type immunoglobulin domain-containing suppressor of T-cell activation isoform 2 precursor
MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.53 | 0.529231473339176 | 0.00033 | 28096329 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)