Host taxon 10090
Protein NP_001139367.1
uncharacterized protein LOC75541 isoform 2
Mus musculus
Gene Nat8f4, UniProt E0CYM0
>NP_001139367.1|Yersinia pseudotuberculosis IP 32953|uncharacterized protein LOC75541 isoform 2
MAFYHIRQYQEKDHKKVLELFSRGMKEHVPAAFHHMLTLPQTLLLLPGVPVTIVLVSGSWLLATVCSFLFLLCLRLLIWLSWRNYVATSLQADLADITKSYLNAHGSFWVAESGDQGADRGSGDSGERSSLMSPRQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.4 | -2.40229912481562 | 3.6e-14 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)