Host taxon 10090
Protein NP_001170820.1
uncharacterized protein LOC623121 isoform a
Mus musculus
Gene Ifi213, UniProt Q3UPZ5
>NP_001170820.1|Yersinia pseudotuberculosis IP 32953|uncharacterized protein LOC623121 isoform a
MTGEMVNYCKQIVLLSGLEYMNDYNFRALKSLLNHDLKLTKNMQDDYDRINIADLMEEKFPEDAGLSKLIEVCEDIPELAARVDILRKEMEKVKNKTKIKSESSPPPLTSSLMEAWEVEPAMVTASSEVHRLRSH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.45 | 2.44561295999101 | 0.0099 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)