Host taxon 10090
Protein NP_001274015.1
uncharacterized protein C1orf43 homolog isoform 3
Mus musculus
Gene 4933434E20Rik, UniProt Q05D39
>NP_001274015.1|Yersinia pseudotuberculosis IP 32953|uncharacterized protein C1orf43 homolog isoform 3
MGKNFRSYLLDLRNTSTPFKGVGKALIDTLLDGYETARYGTGVFGQSEYLRYQEALSELATVVKARIGSSQRQHQSAAKDLTQSPEMSPTTIQVTYLPSSQKSKRPKHFLELKSFKDNYNTLESTL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.76 | 0.764494491170409 | 0.00026 | 28096329 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)