Host taxon 10090
Protein NP_932107.1
uncharacterized protein C1orf21 homolog
Mus musculus
Gene 1700025G04Rik, UniProt Q3TJL3
>NP_932107.1|Yersinia pseudotuberculosis IP 32953|uncharacterized protein C1orf21 homolog
MGCASAKHVATVQNEEEAQRGKSYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQENLEKSASSNTRLKTNKEIPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEEEDIT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.55 | 0.546094952634772 | 0.038 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)