Host taxon 10090
Protein NP_808400.1
UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter isoform 2
Mus musculus
Gene Slc35d1, UniProt A2AKQ0
>NP_808400.1|Yersinia pseudotuberculosis IP 32953|UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter isoform 2
MAEVHRRQHAPVKGEAPAKSSTHRDEEELGMAPAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMVATVAVLWVGKTLRVVKFPDFDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGALLKKTFSWGIKMTVFAMIIGAFVAASSDLAFDLEGYVFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEASNKLDTKGKGAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.61 | -0.609716215400499 | 0.0065 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)