Bacterial taxon 273123
Protein WP_002211825.1
UDP-4-amino-4-deoxy-L-arabinose aminotransferase
Yersinia pseudotuberculosis IP 32953
Gene arnB, UniProt Q7BF87
>WP_002211825.1|Yersinia pseudotuberculosis IP 32953|UDP-4-amino-4-deoxy-L-arabinose aminotransferase
MQSFLPFSRPAIGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLALGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAITPNTKAIIPVHYAGAPCDLDALRQISQRHGIPLIEDAAHAVGTRYRDQWIGEQGTAIFSFHAIKNITCAEGGLVATDDDELAARVRRLKFHGLGVDAFDRQIQGRSPQAEVVEPGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYHKALAHLPLQPLALPHYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHFRAVHSQKYYRERYPHLCLPNTEWNSARLCTLPLFPDMLDSDIERVANALTTIIGSHRVTK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.61 | 1.61254417018909 | 1.7e-11 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.4 | 1.40399182116266 | 1.0e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.19 | -1.19312636394367 | 1.8e-6 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.76 | -0.760359036424525 | 1.3e-6 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 0.8 ms
(Link to these results)