Host taxon 10090
Protein NP_056598.2
ubiquitin-like protein ISG15
Mus musculus
Gene Isg15, UniProt Q64339
>NP_056598.2|Yersinia pseudotuberculosis IP 32953|ubiquitin-like protein ISG15
MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGGDQCA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.67 | 1.66656200662847 | 1.4e-11 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)