Host taxon 10090
Protein NP_001333587.1
ubiquitin-conjugating enzyme E2 Q2 isoform 3
Mus musculus
Gene Ube2q2, UniProt Q8K2Z8
>NP_001333587.1|Yersinia pseudotuberculosis IP 32953|ubiquitin-conjugating enzyme E2 Q2 isoform 3
MLDQPLPTGQNGTTEEVTSEEEEEEEMAEDIEDLDHYEMKEEEPINGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDVYRSQSYKAGIYSVELINDSLYDWHVKLHKVDSDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.84 | 0.844578810343476 | 0.043 | 28096329 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)