Host taxon 10090
Protein NP_663475.1
ubiquitin domain-containing protein 1
Mus musculus
Gene Ubtd1, UniProt Q91WB7
>NP_663475.1|Yersinia pseudotuberculosis IP 32953|ubiquitin domain-containing protein 1
MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPTPSVRREFPLKVRLSTGKDVRLNASLPDTVGQLKRQLHSQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.03 | 1.02797689074067 | 0.0033 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)