Host taxon 10090
Protein NP_291085.1
ubiquitin carboxyl-terminal hydrolase isozyme L4
Mus musculus
Gene Uchl4, UniProt P58321
>NP_291085.1|Yersinia pseudotuberculosis IP 32953|ubiquitin carboxyl-terminal hydrolase isozyme L4
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMESELLSIIPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGTIGLIHAIANNKDKVHFESGSTLKKFLEESVSMSPEERAKYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGWKPFPINHGKTSDETLLEDVIKVCKKFMERDPDELRFNAIALSAA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.25 | 1.24971963526479 | 0.035 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)