Host taxon 10090
Protein NP_056631.2
U6 snRNA-associated Sm-like protein LSm4 isoform 1
Mus musculus
Gene Lsm4, UniProt Q9QXA5
>NP_056631.2|Yersinia pseudotuberculosis IP 32953|U6 snRNA-associated Sm-like protein LSm4 isoform 1
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVREEAAKGRGRGGPQQQKQQKGRGMGGAGRGVFGGRGRGGIPGAGRGQPEKKPGRQAGKQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.69 | -1.69086268579954 | 0.026 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)