Host taxon 10090
Protein NP_035792.1
TYRO protein tyrosine kinase-binding protein precursor
Mus musculus
Gene Tyrobp, UniProt O54885
>NP_035792.1|Yersinia pseudotuberculosis IP 32953|TYRO protein tyrosine kinase-binding protein precursor
MGALEPSWCLLFLPVLLTVGGLSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.99 | 0.992028519887123 | 2.9e-8 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)