Bacterial taxon 273123
Protein WP_002212914.1
type III secretion system inner rod subunit SctI
Yersinia pseudotuberculosis IP 32953
Gene yscI, UniProt P69971
>WP_002212914.1|Yersinia pseudotuberculosis IP 32953|type III secretion system inner rod subunit SctI
MPNIEIAQADEVIITTLEELGPAEPTTDQIMRFDAAMSEDTQGLGHSLLKEVSDIQKSFKTVKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAGRMSQNVETLSKGG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.16 | 2.16218042646803 | 5.8e-12 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.7 | 1.70272259798585 | 2.8e-16 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.88 | 0.877329880830287 | 0.0015 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.74 | -0.742088105894682 | 0.0065 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.7 ms
(Link to these results)