Bacterial taxon 273123
Protein WP_002212973.1
type III secretion protein LcrG
Yersinia pseudotuberculosis IP 32953
Gene lcrG, UniProt P69958
>WP_002212973.1|Yersinia pseudotuberculosis IP 32953|type III secretion protein LcrG
MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAVMKIFAGRSAEEIKPAERELLDEIKRQRERQPQHPYDGKRPRKPTMMRGQII
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.24 | 4.24419551944444 | 4.5e-97 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.08 | 4.07872969270485 | 5.6e-58 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.26 | 1.26239413296901 | 2.2e-10 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.76 | -0.76055640833501 | 0.011 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.6 ms
(Link to these results)