Bacterial taxon 273123
Protein WP_002208913.1
two-component system sensor histidine kinase EnvZ
Yersinia pseudotuberculosis IP 32953
Gene envZ, UniProt Q664K6
>WP_002208913.1|Yersinia pseudotuberculosis IP 32953|two-component system sensor histidine kinase EnvZ
MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKLLSDDRTLLMAGVSHDLRTPLTRIRLATEMMSEDDAYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSDLNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRALTNMVVNAARYGNGWIKVSSGKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSLEIGTSKRGGLRIRAYIPLPLDVKPKPPAVA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.93 | 1.92827662843483 | 5.9e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.32 | 1.32431043905343 | 0.00031 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.13 | -1.12628866128782 | 5.5e-6 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.1 | -1.09827031442851 | 1.8e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 0.9 ms
(Link to these results)