Host taxon 10090
Protein NP_001020433.1
tumor protein D52 isoform 2
Mus musculus
Gene Tpd52, UniProt Q62393
>NP_001020433.1|Yersinia pseudotuberculosis IP 32953|tumor protein D52 isoform 2
MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNVGLLKTEPVAEEGEDAVTMLSAPEALTEEEQEELRRELTKVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQNIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGAKPAGGDFGEVLNSTANATSTMTTEPPPEQMTESP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.63 | 0.633679247719131 | 0.00011 | 28096329 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)