Host taxon 10090
Protein NP_783580.1
tumor necrosis factor receptor superfamily member 26 precursor
Mus musculus
Gene Tnfrsf26, UniProt P83626
>NP_783580.1|Yersinia pseudotuberculosis IP 32953|tumor necrosis factor receptor superfamily member 26 precursor
MTRLRLLLLLGLLLRVAVCSVNTITLCKIGEFKHENLCCLQCSAGTYLRNPCQENHNKSECAPCDSEHFIDHKNRESECFPCSVCRDDQEEVAKCSRTADRVCQCKQGTYCDSENCLERCHTCSSCPDGRVVRKCNATMDTVCDKFDSEPGQSGSQCFCFSKPLGIVVIIAAFIIIIGAVIILILKIICYCKRGENIQLSSTML
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.18 | 2.18022318199979 | 6.7e-8 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)