Host taxon 10090
Protein NP_001155218.1
tumor necrosis factor receptor superfamily member 12A isoform 2 precursor
Mus musculus
Gene Tnfrsf12a, UniProt Q9CR75
>NP_001155218.1|Yersinia pseudotuberculosis IP 32953|tumor necrosis factor receptor superfamily member 12A isoform 2 precursor
MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGAAAPPAHFRLLWPILGGALSLVLVLALVSSFLVWRRCRRREKFTTPIEETGGEGCPGVALIQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.01 | 2.00551103405135 | 7.6e-9 | 28096329 | |
Retrieved 1 of 2 entries in 0.3 ms
(Link to these results)