Host taxon 10090
Protein NP_001171231.1
tumor necrosis factor alpha-induced protein 8 isoform 3
Mus musculus
Gene Tnfaip8, UniProt Q921Z5
>NP_001171231.1|Yersinia pseudotuberculosis IP 32953|tumor necrosis factor alpha-induced protein 8 isoform 3
MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQIVIDLQELNLRQSNRMLRKAKKTVHLKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.77 | 0.766881232210189 | 0.00019 | 28096329 | |
Retrieved 1 of 3 entries in 1.8 ms
(Link to these results)