Host taxon 10090
Protein NP_033347.1
tubulin-specific chaperone A
Mus musculus
Gene Tbca, UniProt P48428
>NP_033347.1|Yersinia pseudotuberculosis IP 32953|tubulin-specific chaperone A
MADPRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQESRMMIPDCQRRLEAAYTDLQQILESEKDLEEAEEYKEARVVLDSVKLEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.55 | 1.54643041057044 | 0.0033 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)