Host taxon 10090
Protein NP_079824.2
tubulin-folding cofactor B isoform 1
Mus musculus
Gene Tbcb, UniProt Q9D1E6
>NP_079824.2|Yersinia pseudotuberculosis IP 32953|tubulin-folding cofactor B isoform 1
MEVTGISAPTVMVFISSSLNSFRSEKRYSRSLTIAEFKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGVRLGEYEDVSKVEKYEISPEAYERRQNTVRSFMKRSKLGPYNEELRAQQEAEAAQRLSEEKAQASAISVGSRCEVRAPDHSLRRGTVMYVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSAVTVGDFPEEDYGLDEM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.63 | -0.625017461445701 | 0.028 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)