Host taxon 10090
Protein NP_080757.1
tubulin polymerization-promoting protein family member 3
Mus musculus
Gene Tppp3, UniProt Q9CRB6
>NP_080757.1|Yersinia pseudotuberculosis IP 32953|tubulin polymerization-promoting protein family member 3
MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.4 | -1.39878632929939 | 2.7e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)