Host taxon 10090
Protein NP_033392.1
TSC22 domain family protein 1 isoform 2
Mus musculus
Gene Tsc22d1, UniProt P62500
>NP_033392.1|Yersinia pseudotuberculosis IP 32953|TSC22 domain family protein 1 isoform 2
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.07 | -1.07481160970537 | 8.6e-8 | 28096329 | |
Retrieved 1 of 6 entries in 2 ms
(Link to these results)