Host taxon 10090
Protein NP_035705.1
trefoil factor 3 precursor
Mus musculus
Gene Tff3, UniProt Q62395
>NP_035705.1|Yersinia pseudotuberculosis IP 32953|trefoil factor 3 precursor
METRALWLMLLVVLVAGSSGIAADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.6 | -2.60068499621772 | 1.1e-35 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)