Host taxon 10090
Protein NP_898983.1
transmembrane protein 252
Mus musculus
Gene Tmem252, UniProt Q8C353
>NP_898983.1|Yersinia pseudotuberculosis IP 32953|transmembrane protein 252
MQNRTGLILCALSLLTGFLMICLGGFFISNSIFHSQRNLVVAYVLLPMGFVILLSGIFWGTYRQANENKEMFNHVLRQHLAFQDLPLATVDRPDFYPPAYEESLDVEKQACPAGRELLGFPPPLYTETNLEFEHLEDPQPEAPPPYQEIIADAGAPAKAQDAEEPSRVLKAGTALQLTELTGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.58 | 1.58495231138938 | 9.7e-7 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)