Host taxon 10090
Protein NP_001163872.1
transmembrane protein 229B
Mus musculus
Gene TMEM229B, UniProt Q8BFQ2
>NP_001163872.1|Yersinia pseudotuberculosis IP 32953|transmembrane protein 229B
MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIVERMYLRLRGRCPLLVRCVIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEYAVPWFCGALIMEQFIIRNTLRLRFDKDAEPGEPASPPALANGHVKTD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.49 | -0.487284056825392 | 0.031 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)