Host taxon 10090
Protein NP_001157044.1
transmembrane protein 170B isoform 1
Mus musculus
Gene Tmem170b, UniProt P86050
>NP_001157044.1|Yersinia pseudotuberculosis IP 32953|transmembrane protein 170B isoform 1
MRAEGADHSMINLSVQQVLSLWAHGTVLRNLTEMWYWIFLWALFSSLFVHGAAGVLMFVMLQRHRQGRVISIIAVSIGFLASVTGAMITSAAVAGIYRVAGKNMAPLEALVWGVGQTVLTLIISFSRILATL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 1 | 0.997399050157719 | 2.1e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)