Host taxon 10090
Protein NP_080709.1
transmembrane protein 100
Mus musculus
Gene Tmem100, UniProt Q9CQG9
>NP_080709.1|Yersinia pseudotuberculosis IP 32953|transmembrane protein 100
MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPFAVVVFITGIVVTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRESQTALVVNQRCLFA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.34 | 1.3443607850321 | 0.035 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)