Host taxon 10090
Protein NP_001300890.1
transforming protein RhoA precursor
Mus musculus
Gene Rhoa, UniProt Q9QUI0
>NP_001300890.1|Yersinia pseudotuberculosis IP 32953|transforming protein RhoA precursor
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.34 | 1.34408131981468 | 0.00038 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)