Bacterial taxon 273123
Protein WP_002210280.1
transcriptional regulator LrhA
Yersinia pseudotuberculosis IP 32953
Gene pecT, UniProt Q668Z9
>WP_002210280.1|Yersinia pseudotuberculosis IP 32953|transcriptional regulator LrhA
MTNANRPIINLDLDLLRTFVAVADLNTFAAAAAAVCRTQSAVSQQMQRLEQLVGKELFARHGRNKLLTEHGLQLLGYARKILRFNDEACTSLMYSNMEGSLIIGASDDTADTLLPFLLNRVATLYPRLAIDVRVKRSPFIADMLSSGEVDLAITTAKVDSHPHVILRTSPTLWYCSVDYQFQPGEPVPLVVMDEPSLYREMAIEHLTQAGVPWRIAYVASSLSAIRAAVRAGLGVTARPIEMMSPDLRVLGETEGLPGLPETRYVLCKDKQCDNELALAIFSALQNSYQHTMSSESSLILDSDYLTGDED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.89 | -1.89159209377553 | 1.5e-5 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.31 | -1.31174847418967 | 0.018 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.19 | 1.19018338932454 | 0.014 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.15 | 1.14987833485031 | 0.022 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.8 ms
(Link to these results)