Host taxon 10090
Protein NP_081207.1
transcriptional and immune response regulator
Mus musculus
Gene Tcim, UniProt Q9D915
>NP_081207.1|Yersinia pseudotuberculosis IP 32953|transcriptional and immune response regulator
MKAKPSHQATSMSSSLRVSPSIHGYHFDTAARKKAVGNIFENIDQESLQRLFRNSGDKKAEERAKIIFAIDQDLEEKTRALMALKKRTKDKLLQFLKLRKYSIKVH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.22 | -1.22389121151093 | 9.5e-10 | 28096329 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)