Host taxon 10090
Protein NP_035591.3
transcription factor Spi-C
Mus musculus
Gene Spic, UniProt Q6P3D7
>NP_035591.3|Yersinia pseudotuberculosis IP 32953|transcription factor Spi-C
MTCCIDQDSLGQTFQDAIDILIQQSAGESQYSSENRNYMAIINPYPHVRGNANYYGMSPTENPLYDWRGVTNGSADLYLEGGFHQSVQNIAESQLVQPPFFQQKGGRGRRKLRLFEYLFESLCNSEMVSCIQWVDKARGIFQFISKNKETLAELWGQRKGNRKPMTYQKMARALRNYARTGEIIKIRRKLTYQFSEAVLQRLAPANYLGKDLFYPQYGQPDQGYLSLNHWNANHYAHGSYQS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.29 | 2.29168101328636 | 0.00046 | 28096329 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)