Host taxon 10090
Protein NP_034549.1
transcription factor HES-5 isoform 1
Mus musculus
Gene Hes5, UniProt P70120
>NP_034549.1|Yersinia pseudotuberculosis IP 32953|transcription factor HES-5 isoform 1
MAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAPAAPAKEPPAPGAAPQPARSSAKAAAAAVSTSRQPACGLWRPW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.97 | -1.97214971489848 | 0.0057 | 28096329 | |
Retrieved 1 of 2 entries in 1.4 ms
(Link to these results)