Host taxon 10090
Protein NP_001162050.1
transcription elongation factor A protein-like 8
Mus musculus
Gene Tceal8, UniProt Q9CZY2
>NP_001162050.1|Yersinia pseudotuberculosis IP 32953|transcription elongation factor A protein-like 8
MQKSCDENEGTPQNTPKADEGHPSEDPPQQAGETLQASGENVREETEGSHRGEPAEPSPEPKEDTPARHLNPEEVIRGVDELERLREEIRRVRNKFVLMHWKQRHSRSRPYPVCFRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.08 | 1.07687453291897 | 0.0063 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)