Host taxon 10090
Protein NP_778174.1
transcription and mRNA export factor ENY2
Mus musculus
Gene Eny2, UniProt Q9JIX0
>NP_778174.1|Yersinia pseudotuberculosis IP 32953|transcription and mRNA export factor ENY2
MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.87 | 0.872935310425403 | 0.024 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)