Host taxon 10090
Protein NP_001162086.1
TRAF-interacting protein with FHA domain-containing protein B
Mus musculus
Gene Tifab, UniProt Q8JZM6
>NP_001162086.1|Yersinia pseudotuberculosis IP 32953|TRAF-interacting protein with FHA domain-containing protein B
MERPLTVLQVSLYHPTQGPVAFAHVPQQLQHDASRLLVGRGQNTHLQLQLPQLSRYHLSLEPYLEKGSSLLAFCLKVLTRKSCVWVNGLPLRYLEQVPLGTINRISFSGIQMLVRKEGGASLETFVCYFHLSPSPLIYRPKAQETDE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.62 | 0.616980665850256 | 0.016 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)