Host taxon 10090
Protein NP_660115.1
TRAF-interacting protein with FHA domain-containing protein A
Mus musculus
Gene Tifa, UniProt Q793I8
>NP_660115.1|Yersinia pseudotuberculosis IP 32953|TRAF-interacting protein with FHA domain-containing protein A
MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIEVVKFGRNSNMCQYTFQDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELGYLNKMDLPYKCMLRFGEYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPEDGMYSSYFTHRSSPSEMDENEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.98 | 1.98266380063497 | 2.5e-18 | 28096329 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)