Host taxon 10090
Protein NP_001157544.1
TRAF family member-associated NF-kappa-B activator isoform 2
Mus musculus
Gene Tank, UniProt P70347
>NP_001157544.1|Yersinia pseudotuberculosis IP 32953|TRAF family member-associated NF-kappa-B activator isoform 2
MDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKTENYEQRIREQQEQLSFQQNLIDRLKSQLLLVDSSRDNSYGYVPLLEDSDRRKNNLTLDEPHDKVKLGTLRDKQSKVRRQEVSSGKESAKGLNIPLHHERDNIEKTFWDLKEEFHRICLLAKAQKDHLSKLNIPDIATDTQCSVPIQCTDKTEKQEALFKPQAKDDINRGMSCVTAVTPRGLGRDEEDTSFESLSKFNVKFPPMDNDSIFLHSTPEAPSILAPATPETVCQDRFNMEVRDNPGNFVKTEETLFEIQGIDPITSAIQNLKTTDKTNPSNLRATCLPAGDHNVFYVNTFPLQDPPDAPFPSLDSPGKAVRGPQQPFWKPFLNQDTDLVVPSDSDSELLKPLVCEFCQELFPPSITSRGDFLRHLNTHFNGET
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.75 | 0.747344748319684 | 0.0046 | 28096329 | |
Retrieved 1 of 5 entries in 0.9 ms
(Link to these results)